Recombinant Full Length Conjugal Transfer Protein Trag(Trag) Protein, His-Tagged
Cat.No. : | RFL16728EF |
Product Overview : | Recombinant Full Length Conjugal transfer protein traG(traG) Protein (Q00184) (1-637aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-637) |
Form : | Lyophilized powder |
AA Sequence : | MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHV YAPWSILHWTYKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSA RWAEKKDIQAAGLLPRERNVLEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLT YAPTRSGKGVGLVVPTLLSWGASSVITDLKGELWALTAGWRQKHAKNKVLRFEPASTSGG VCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQKTAFALLVGVILHALYKAKD DGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMMDRPEEEAGSV LSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQ DINQLKSRETGYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRT AAMLGQVSRTYQEVQRPLLTPDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPL YFKDPVFSARAAIPAPKVSDRLRAVAQADTEGEGITI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | traG |
Synonyms | traG; Conjugal transfer protein TraG |
UniProt ID | Q00184 |
◆ Recombinant Proteins | ||
SHMT2-927H | Recombinant Human SHMT2 Protein, His-tagged | +Inquiry |
FRAT1-4490H | Recombinant Human FRAT1 Protein, GST-tagged | +Inquiry |
ACR-464R | Recombinant Rat ACR Protein | +Inquiry |
MTR-9794Z | Recombinant Zebrafish MTR | +Inquiry |
AYP1020-RS08200-5976S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS08200 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
VTI1A-001HCL | Recombinant Human VTI1A cell lysate | +Inquiry |
SLC7A6OS-1696HCL | Recombinant Human SLC7A6OS 293 Cell Lysate | +Inquiry |
SDCCAG3-2013HCL | Recombinant Human SDCCAG3 293 Cell Lysate | +Inquiry |
FKBP7-1314HCL | Recombinant Human FKBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All traG Products
Required fields are marked with *
My Review for All traG Products
Required fields are marked with *
0
Inquiry Basket