Recombinant Full Length Rhizobium Radiobacter Conjugal Transfer Protein Trag(Trag) Protein, His-Tagged
Cat.No. : | RFL904RF |
Product Overview : | Recombinant Full Length Rhizobium radiobacter Conjugal transfer protein traG(traG) Protein (Q44360) (1-640aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-640) |
Form : | Lyophilized powder |
AA Sequence : | MTVNRLLLLILPAAIMVAAMILTSGMEHRLAALGTTVQAKLMLGRAGLALPYIVAAAIGV IALFATNGSANIKAAGLSVLGGGAAVIIVAIAREIIRLNGISSHVPAGQSVLAYCDPATM VGAAAALFSGIFGLRVALKGNAAFATGGPRRIGGKRAVHGETDWMKMQEAAKLFPDTGGI VIGERYRVDRDSVAAMPFRADEKQSWGAGGKVPLLCFNGSFGSSHGIVFAGSGGFKTTSV TLPTALKWSSGLVVLDPSSEVAPMISEHRRQAGRKVIVLDPTASGVGFNALDWIGRHGNT KEEDIVAVATWIMTDNPRTASARDDFFRASAMQLLTALIADVCLSGHTEGEDQTLRQVRA NLSEPEPKLRARLTKIYEGSESDFVKENVAVFVNMTPETFSGVYANAVKETHWLSYPNYA GLVSGDSFSTGDLADGRTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRTLF LLDEVARLGYLRILETARDAGRKYGITLTMIFQSLGQMREAYGGRDATSKWFESASWISF SAINDPDTADYISKRCGDTTVEVDQTNRSTGMKGSSRSRSKQLSRRPLILPHEVLRMRGD EQIVFTSGNPPLRCGRAIWFRRDDMSASVGENRFQPENKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | traG |
Synonyms | traG; Conjugal transfer protein TraG |
UniProt ID | Q44360 |
◆ Recombinant Proteins | ||
Camk4-754M | Recombinant Mouse Camk4 Protein, MYC/DDK-tagged | +Inquiry |
ZNHIT3-10607Z | Recombinant Zebrafish ZNHIT3 | +Inquiry |
ZBTB18-6290H | Recombinant Human ZBTB18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HDAC1-5732C | Recombinant Chicken HDAC1 | +Inquiry |
SIGB-0058B | Recombinant Bacillus subtilis SIGB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSBG2-18HCL | Recombinant Human ACSBG2 cell lysate | +Inquiry |
RHBDL1-2360HCL | Recombinant Human RHBDL1 293 Cell Lysate | +Inquiry |
ADPRHL1-9002HCL | Recombinant Human ADPRHL1 293 Cell Lysate | +Inquiry |
PEX16-3290HCL | Recombinant Human PEX16 293 Cell Lysate | +Inquiry |
ZNF263-2001HCL | Recombinant Human ZNF263 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All traG Products
Required fields are marked with *
My Review for All traG Products
Required fields are marked with *
0
Inquiry Basket