Recombinant Full Length Colwellia Psychrerythraea Upf0761 Membrane Protein Cps_0609(Cps_0609) Protein, His-Tagged
Cat.No. : | RFL8993CF |
Product Overview : | Recombinant Full Length Colwellia psychrerythraea UPF0761 membrane protein CPS_0609(CPS_0609) Protein (Q489A5) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colwellia Psychrerythraea |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MLTNMSLFNEKKLISFWHDNKELLFYFTRRVRREQIQVVAGYLSYVCLMSLVPLIVVMLS VMTAFPLFAELQQSIEQFVYQNFVPAAGDVVQQYLTGFVANASKMSAVAISFLFLAALLL ISSIDNTFNKIWRVTDKRRTITSFAMYWMVLTLGPILVGASIALSSYLVSIVAVDEYDVL GLSDMFLRMLPLLSSIIAFIILYIAVPNKAVPFRFALSGAIVAGVLFELAKKAFALYITA FPSYQVIYGALATIPIIFLWVYVSWIIVLTGALITVSLQEYEILKEKKVKESDRAQVKDE EIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CPS_0609 |
Synonyms | CPS_0609; UPF0761 membrane protein CPS_0609 |
UniProt ID | Q489A5 |
◆ Recombinant Proteins | ||
CELSR2-5074Z | Recombinant Zebrafish CELSR2 | +Inquiry |
APOC4-636M | Recombinant Mouse APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
bipD-1410B | Recombinant Burkholderia pseudomallei (strain 1710b) bipD protein, His&Myc-tagged | +Inquiry |
KRT17-2826H | Recombinant Human KRT17 protein(71-400 aa), C-His-tagged | +Inquiry |
CCNYL1-3046H | Recombinant Human CCNYL1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP10-2070HCL | Recombinant Human DPP10 cell lysate | +Inquiry |
PVR-2270CCL | Recombinant Cynomolgus PVR cell lysate | +Inquiry |
SNAPC5-1636HCL | Recombinant Human SNAPC5 293 Cell Lysate | +Inquiry |
Jurkat-256H | Human Jurkat Membrane Lysate | +Inquiry |
MRPL52-4157HCL | Recombinant Human MRPL52 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPS_0609 Products
Required fields are marked with *
My Review for All CPS_0609 Products
Required fields are marked with *
0
Inquiry Basket