Recombinant Full Length Clostridium Acetobutylicum Putative Zinc Metalloprotease Ca_C1796(Ca_C1796) Protein, His-Tagged
Cat.No. : | RFL29210CF |
Product Overview : | Recombinant Full Length Clostridium acetobutylicum Putative zinc metalloprotease CA_C1796(CA_C1796) Protein (Q97I57) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Acetobutylicum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MSFFNIVIAILAFGVLILIHELGHFVLAKLNDVKVEEFAIGMGPKLLGIKGKETQYSIRA LPIGGYVKMLGDESKSDDPRAFNNKSSARRLSIVIAGPIMNLILAAVLFCIVGMSEGIAL PTVGKISANSPAQKIGIKAGDTIVKINNYSVHTWEDISFNMALNKGEGIKLALKNNGTIK KVTLVPQYSKKEKMYLIGISPKFIDKPTIIEGAKYGTSETVTMIKTVYLSLKMMVTGKAS AKDVSGPVSIIKVTGAAANAGFIRLVNFIAFISAQLGVMNLLPIPALDGGFVFLFLFQMI TGKKVDDDKVGFVNTIGFALLMILMIVVTIKDVVYPINF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CA_C1796 |
Synonyms | CA_C1796; Putative zinc metalloprotease CA_C1796 |
UniProt ID | Q97I57 |
◆ Recombinant Proteins | ||
Rdh14-274M | Recombinant Mouse Rdh14 Protein, MYC/DDK-tagged | +Inquiry |
NA-0387H | Active Recombinant Influenza A H1N1 Neuraminidase / NA (H275Y) NA protein | +Inquiry |
GPC3-620H | Active Recombinant Human GPC3, Fc-tagged | +Inquiry |
STX12-4358R | Recombinant Rhesus Macaque STX12 Protein, His (Fc)-Avi-tagged | +Inquiry |
FABP5-3366H | Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-9H | Human Adult Thymus Membrane Lysate | +Inquiry |
COL9A3-7374HCL | Recombinant Human COL9A3 293 Cell Lysate | +Inquiry |
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
DLGAP4-484HCL | Recombinant Human DLGAP4 cell lysate | +Inquiry |
TMPRSS11A-693HCL | Recombinant Human TMPRSS11A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA_C1796 Products
Required fields are marked with *
My Review for All CA_C1796 Products
Required fields are marked with *
0
Inquiry Basket