Recombinant Human FABP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FABP5-3366H
• Product Overview: FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 15.2 kDa
• AA Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FABP5 fatty acid binding protein 5 [ Homo sapiens (human) ]
• Official Symbol: FABP5
• Synonyms: FABP5; fatty acid binding protein 5 (psoriasis-associated); fatty acid-binding protein, epidermal; E FABP; KFABP; PA FABP; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog; EFABP; E-FABP; PAFABP; PA-FABP
• Gene ID: 2171
• mRNA Refseq: NM_001444
• Protein Refseq: NP_001435
• MIM: 605168
• UniProt ID: Q01469