Recombinant Full Length Chlamydia Trachomatis Serovar A Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL14965CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub1(cdu1) Protein (Q3KKG8) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSISKTVPAPPQDSSKPVLISEEPQNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEHPTISIPEPLPSPPLAVPRPSTPPPPVISRPSTPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRQIIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLQGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMKKDLQSFAQQLDQVYPACDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVRACEAAVQDLPELFWPEAKALF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; CTA_0948; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | Q3KKG8 |
◆ Recombinant Proteins | ||
HMGCR-3114H | Recombinant Human HMGCR Protein, His (Fc)-Avi-tagged | +Inquiry |
ECI2-2627M | Recombinant Mouse ECI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC74A-3928HF | Recombinant Full Length Human CCDC74A Protein, GST-tagged | +Inquiry |
STARD13-4327R | Recombinant Rhesus Macaque STARD13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARC-400R | Recombinant Rat ARC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CAT-1646H | Native Human Catalase Protein | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL3-7183HCL | Recombinant Human CUL3 293 Cell Lysate | +Inquiry |
RNPS1-2258HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
CDC23-7667HCL | Recombinant Human CDC23 293 Cell Lysate | +Inquiry |
PHPT1-3215HCL | Recombinant Human PHPT1 293 Cell Lysate | +Inquiry |
CCDC116-150HCL | Recombinant Human CCDC116 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket