Recombinant Full Length Human CCDC74A Protein, GST-tagged
Cat.No. : | CCDC74A-3928HF |
Product Overview : | Human CCDC74A full-length ORF ( NP_620125.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 378 amino acids |
Description : | CCDC74A (Coiled-Coil Domain Containing 74A) is a Protein Coding gene. An important paralog of this gene is CCDC74B. |
Molecular Mass : | 68 kDa |
AA Sequence : | MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCINGVWVEPGGPSPARLKEGSSRTHRPGGKRGRLAGGSADTVRSPADSLSMSSFQSVKSISNSGKARPQPGSFNKQDSKADVSQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAGAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATHFPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC74A coiled-coil domain containing 74A [ Homo sapiens (human) ] |
Official Symbol | CCDC74A |
Synonyms | CCDC74A; coiled-coil domain containing 74A; coiled-coil domain-containing protein 74A |
Gene ID | 90557 |
mRNA Refseq | NM_001258304 |
Protein Refseq | NP_001245233 |
UniProt ID | Q96AQ1 |
◆ Recombinant Proteins | ||
CCDC74A-3928HF | Recombinant Full Length Human CCDC74A Protein, GST-tagged | +Inquiry |
CCDC74A-5201H | Recombinant Human CCDC74A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC74A-7749HCL | Recombinant Human CCDC74A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC74A Products
Required fields are marked with *
My Review for All CCDC74A Products
Required fields are marked with *
0
Inquiry Basket