Recombinant Full Length Chicken Tetraspanin-12(Tspan12) Protein, His-Tagged
Cat.No. : | RFL17354GF |
Product Overview : | Recombinant Full Length Chicken Tetraspanin-12(TSPAN12) Protein (Q5ZIF5) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MAREDSVRCLRCLLYALNLLFWLMSISVLGVSAWIRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLILVGMLGYCGTVKRNLLLLVWYFGSLLVIFCVELACGVWTYEQEIT VPVQWSDMITLKARMTNYGLPRYQWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHHEDLSDLYQEGCGKKMYTFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRRDPGADQIMSLKNDTSQQLSCHSVELLKPSLTGIFEHTSMANSFNTHF EMEEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN12 |
Synonyms | TSPAN12; RCJMB04_27b23; Tetraspanin-12; Tspan-12 |
UniProt ID | Q5ZIF5 |
◆ Native Proteins | ||
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
PLE-172P | Active Native Porcine Esterase | +Inquiry |
Lectin-1718P | Native Peanut Lectin, PE conjugated | +Inquiry |
CRP-8374H | Native Human CRP | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBLAC2-4442HCL | Recombinant Human MBLAC2 293 Cell Lysate | +Inquiry |
C5-8020HCL | Recombinant Human C5 293 Cell Lysate | +Inquiry |
HA-001H7N9CL | Recombinant H7N9 HA cell lysate | +Inquiry |
CA9-2189MCL | Recombinant Mouse CA9 cell lysate | +Inquiry |
ANXA11-8837HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSPAN12 Products
Required fields are marked with *
My Review for All TSPAN12 Products
Required fields are marked with *
0
Inquiry Basket