Recombinant Full Length Mouse Tetraspanin-12(Tspan12) Protein, His-Tagged
Cat.No. : | RFL32500MF |
Product Overview : | Recombinant Full Length Mouse Tetraspanin-12(Tspan12) Protein (Q8BKT6) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGTLLVIFCVELACGVWTYEQEVM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNYFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMLSLKNDTSQHLSCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tspan12 |
Synonyms | Tspan12; Tm4sf12; Tetraspanin-12; Tspan-12; Transmembrane 4 superfamily member 12 |
UniProt ID | Q8BKT6 |
◆ Recombinant Proteins | ||
EXOC6B-4410HF | Recombinant Full Length Human EXOC6B Protein, GST-tagged | +Inquiry |
GPR3-5229H | Recombinant Human GPR3 Protein, GST-tagged | +Inquiry |
ANXA11-2118C | Recombinant Chicken ANXA11 | +Inquiry |
PRKCD-0199H | Recombinant Human PRKCD Protein (A2-D676), GST tagged | +Inquiry |
ARHGAP17-763R | Recombinant Rat ARHGAP17 Protein | +Inquiry |
◆ Native Proteins | ||
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT2-1419HCL | Recombinant Human STAT2 293 Cell Lysate | +Inquiry |
C4orf26-117HCL | Recombinant Human C4orf26 lysate | +Inquiry |
DDX42-456HCL | Recombinant Human DDX42 cell lysate | +Inquiry |
TEK-415HCL | Recombinant Human TEK cell lysate | +Inquiry |
PCSK1N-1316HCL | Recombinant Human PCSK1N cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tspan12 Products
Required fields are marked with *
My Review for All Tspan12 Products
Required fields are marked with *
0
Inquiry Basket