Recombinant Full Length Chicken Protein Yipf3(Yipf3) Protein, His-Tagged
Cat.No. : | RFL19998GF |
Product Overview : | Recombinant Full Length Chicken Protein YIPF3(YIPF3) Protein (Q5F384) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MSAPGGGRSGPAEWGGFEDNMQGGGSAVIDMENMDDTSGSSFEDMGEMHQRMKEEEEEEA EGEAGAGGEEDGEFLGMKGLQGQLGRQVADQMWQVGKRQASKAFSLYANIDILRPYFDVE PVQVRTRLLESMVPVKMINFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTLMG TAIGTCFGYWLGVSSFIYFLAYLCNAQITMVQMLSLLGYGLFGHCITLLVTYNIHFHSLF YIFWLVVGGLSTLRMVAVLVSRTVGHTQRLILCGTLAALHMLFLLYLHFAYHKVVEGILD TLEGPNMPPFQRVARDIPVVSNAVLNTTAKANAMTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIPF3 |
Synonyms | YIPF3; RCJMB04_29b14; Protein YIPF3; YIP1 family member 3 |
UniProt ID | Q5F384 |
◆ Recombinant Proteins | ||
SLC4A2-6522C | Recombinant Chicken SLC4A2 | +Inquiry |
ILTIFB-8189M | Recombinant Mouse ILTIFB Protein | +Inquiry |
TAB3-4149Z | Recombinant Zebrafish TAB3 | +Inquiry |
WDR21-10966Z | Recombinant Zebrafish WDR21 | +Inquiry |
FGFR1-384H | Recombinant Human FGFR1 protein, Strep-tagged | +Inquiry |
◆ Native Proteins | ||
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
◆ Cell & Tissue Lysates | ||
HK1-794HCL | Recombinant Human HK1 cell lysate | +Inquiry |
GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
L3MBTL3-4833HCL | Recombinant Human L3MBTL3 293 Cell Lysate | +Inquiry |
PRR14-2815HCL | Recombinant Human PRR14 293 Cell Lysate | +Inquiry |
Tonsil-535C | Cynomolgus monkey Tonsil Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YIPF3 Products
Required fields are marked with *
My Review for All YIPF3 Products
Required fields are marked with *
0
Inquiry Basket