Recombinant Full Length Danio Rerio Protein Yipf3(Yipf3) Protein, His-Tagged
Cat.No. : | RFL5028DF |
Product Overview : | Recombinant Full Length Danio rerio Protein YIPF3(yipf3) Protein (Q803Z2) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MSASQGSKNTNAEPWGGFDDNIIQGTGSAVIDMENMDDTSGSSFEDVGEMHQRMREEEEV TAEAAATEEDNGEYGEFLGMKGLKGQLGRQVADEVWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRNRLVESLIPVRMINFPQKVAGELYGPMMLVFTLVAILLHGMKTSGTVIREGT LMGTAIGTGFGYWLGVSSFIYFLAYLCNAQITMLQMLSLLGYGLFGHCVVLFITYNVHFH SLFYLLWMVIGGLSTLRMVAVLISRTVGQTPRLILCGSLAALHMLFLLYLHFAYHKMVEG ILDTLEGPNIPPIQRVARDVPVVASAVVNATVKSIAAIVQSQQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yipf3 |
Synonyms | yipf3; zgc:55279; Protein YIPF3; YIP1 family member 3 |
UniProt ID | Q803Z2 |
◆ Recombinant Proteins | ||
BTK-5806C | Recombinant Chicken BTK | +Inquiry |
Sostdc1-01MFL | Recombinant Mouse USAG1 Protein, Full Length | +Inquiry |
CDKN1B-3259H | Recombinant Human CDKN1B protein, His-tagged | +Inquiry |
ALAS2-431H | Recombinant Human ALAS2 Protein, GST-tagged | +Inquiry |
RFL364BF | Recombinant Full Length Bovine Claudin-5(Cldn5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
PDE1A-3353HCL | Recombinant Human PDE1A 293 Cell Lysate | +Inquiry |
GAS2L3-688HCL | Recombinant Human GAS2L3 cell lysate | +Inquiry |
AMACR-8888HCL | Recombinant Human AMACR 293 Cell Lysate | +Inquiry |
Stomach-866R | Mini Rabbit Stomach Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yipf3 Products
Required fields are marked with *
My Review for All yipf3 Products
Required fields are marked with *
0
Inquiry Basket