Recombinant Full Length Xenopus Laevis Protein Yipf3(Yipf3) Protein, His-Tagged
Cat.No. : | RFL14269XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein YIPF3(yipf3) Protein (Q3B8G4) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-341) |
Form : | Lyophilized powder |
AA Sequence : | MANSSGSSRNLTAADWGGFDDNMQSGGGAAVIDMENMDDTSGSSFEDMGEIHQHMKEEEE EVEGEGVPEDGEEDGAFLGMKGVQGQLGRQVADEMWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRHRLLESMIPVKMISFPQKIAGELYGPLMLVFTMVAILLHGMKSSGTIIREGT LMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQTLSLLGYGLFGHCIVLFITYNIHFH SLFYIFWLCIGGLSTLRMVAVLLSRTVGHTQRLIVCGTMAALHMLFLLYLHFAYHKVVEG ILDTLDGQNVPLPIQRVARDLPVGPNTVLNATVQVLLAHSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yipf3 |
Synonyms | yipf3; Protein YIPF3; YIP1 family member 3 |
UniProt ID | Q3B8G4 |
◆ Recombinant Proteins | ||
SMIM1-7962Z | Recombinant Zebrafish SMIM1 | +Inquiry |
RPS6KA1-4010H | Recombinant Human RPS6KA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AXJ01-GP148-6233S | Recombinant Staphylococcus phage SPbeta-like (nat-host: Staphylococcus epidermidis 36-1) AXJ01_GP148 protein, His-tagged | +Inquiry |
IGHMBP2-3012R | Recombinant Rat IGHMBP2 Protein | +Inquiry |
KIAA1407-641C | Recombinant Cynomolgus KIAA1407 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KS-01P | Native Pig protein | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
BFSP2-8461HCL | Recombinant Human BFSP2 293 Cell Lysate | +Inquiry |
RNF2-2284HCL | Recombinant Human RNF2 293 Cell Lysate | +Inquiry |
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
TUBE1-645HCL | Recombinant Human TUBE1 293 Cell Lysate | +Inquiry |
GIP-5930HCL | Recombinant Human GIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yipf3 Products
Required fields are marked with *
My Review for All yipf3 Products
Required fields are marked with *
0
Inquiry Basket