Recombinant Full Length Macaca Mulatta Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL11780MF |
Product Overview : | Recombinant Full Length Macaca mulatta Neuropeptide Y receptor type 2(NPY2R) Protein (Q9GK74) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MGPIGTEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLVVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKSHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NPY2R |
Synonyms | NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | Q9GK74 |
◆ Recombinant Proteins | ||
EPO-4083H | Recombinant Human EPO Protein (Met1-Arg193), C-Fc tagged | +Inquiry |
CARM1-098H | Recombinant Human CARM1 Protein, GST-tagged | +Inquiry |
SPINK1-15H | Recombinant Human SPINK1 Protein, N-Met,N-His-tagged | +Inquiry |
HNRNPC-31724TH | Recombinant Human HNRNPC, His-tagged | +Inquiry |
KLHL41B-9883Z | Recombinant Zebrafish KLHL41B | +Inquiry |
◆ Native Proteins | ||
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
Collagen-60H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLS-3255HCL | Recombinant Human PGLS 293 Cell Lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
RIMS2-1510HCL | Recombinant Human RIMS2 cell lysate | +Inquiry |
TTC17-1853HCL | Recombinant Human TTC17 cell lysate | +Inquiry |
NRG3-3697HCL | Recombinant Human NRG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *
0
Inquiry Basket