Recombinant Full Length Chicken 3-Hydroxyacyl-Coa Dehydratase(Ptplad1) Protein, His-Tagged
Cat.No. : | RFL27872GF |
Product Overview : | Recombinant Full Length Chicken 3-hydroxyacyl-CoA dehydratase(PTPLAD1) Protein (Q5ZM57) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIE FLEPVEPKPVCRVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL KEKEEEKINKMKIESRVPKDPFKHLKKGYLIMYNLVQFLGFSWIFVNMTVRLFILGKDSF YDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQS KAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQS IPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRK MK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HACD3 |
Synonyms | HACD3; PTPLAD1; RCJMB04_3b6; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase; 3-hydroxyacyl-CoA dehydratase; HACD; Protein-tyrosine phosphatase-like A domain-containing protein 1 |
UniProt ID | Q5ZM57 |
◆ Native Proteins | ||
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-856R | Mini Rabbit Heart Membrane Lysate, Total Protein | +Inquiry |
GCSH-5975HCL | Recombinant Human GCSH 293 Cell Lysate | +Inquiry |
TSPY3-701HCL | Recombinant Human TSPY3 293 Cell Lysate | +Inquiry |
CAPN3-7862HCL | Recombinant Human CAPN3 293 Cell Lysate | +Inquiry |
MRPS14-4151HCL | Recombinant Human MRPS14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HACD3 Products
Required fields are marked with *
My Review for All HACD3 Products
Required fields are marked with *
0
Inquiry Basket