Recombinant Full Length Capsular Polysaccharide Biosynthesis Protein Capd(Capd) Protein, His-Tagged
Cat.No. : | RFL17227SF |
Product Overview : | Recombinant Full Length Capsular polysaccharide biosynthesis protein CapD(capD) Protein (P39853) (1-599aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-599) |
Form : | Lyophilized powder |
AA Sequence : | MTSISAKLRFLILIIIDSFIVTFSVFLGYAILEPYFKGYSIDLLVLSSVILLVSHHIFAY VFNLYHRAWEYASVSELMSVLKAVTSSIVVTLLLVSLLISESPFLRLYFITWMMHLLLIG GSRLFWRVYRRYFIDNAVEKKATLVVGAGQGGSVLIREMLRSQDMRMQPVLAVDDDKNKQ KMTITERVKVQGYVEDIPELVKKFRIKKIIIAIPTLSQKRLNEINKICNIEGVELFKMPN IEDVLSGELEVNNLKKVEVEDLLGRDPVELDMALISRELTNKTILVTGAGGSIGSEICRQ VSKFDPQKIILLGHGENSIYSIHQELSKTYGNRIEFVPVIADVQNKTRILEVMNEFKPYA VYHAAAHKHVPLMEYNPHEAIRNNILGTKNVAESAKEGEVSKFVMISTDKAVNPSNVMGA TKRIAEMVIQSLNEDNSKTSFVAVRFGNVLGSRGSVIPLFKNQIESGGPVTVTHPEMTRY FMTIPEASRLVLQAGALAQGGEVFVLDMGKPVKIVDLAKNLIRLSGKKEEDIGIEFSGIR PGEKLYEELLNKNEIHPQQVYEKIYRGKVDHYIKTEVDLIVEDLINNFSKEKLLKIANR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | capD |
Synonyms | capD; Capsular polysaccharide biosynthesis protein CapD |
UniProt ID | P39853 |
◆ Recombinant Proteins | ||
CMPK1-3629M | Recombinant Mouse CMPK1 Protein | +Inquiry |
C2CD4C-421R | Recombinant Rhesus Macaque C2CD4C Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTK1-4198C | Recombinant Chicken GSTK1 | +Inquiry |
Tfip11-6382M | Recombinant Mouse Tfip11 Protein, Myc/DDK-tagged | +Inquiry |
Pde3b-4744M | Recombinant Mouse Pde3b Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCXR-7030HCL | Recombinant Human DCXR 293 Cell Lysate | +Inquiry |
CNTFR-687HCL | Recombinant Human CNTFR cell lysate | +Inquiry |
CTCF-7213HCL | Recombinant Human CTCF 293 Cell Lysate | +Inquiry |
FUT8-497HCL | Recombinant Human FUT8 cell lysate | +Inquiry |
HSD17B10-5376HCL | Recombinant Human HSD17B10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All capD Products
Required fields are marked with *
My Review for All capD Products
Required fields are marked with *
0
Inquiry Basket