Recombinant Full Length Candida Glabrata Spore Membrane Assembly Protein 2(Sma2) Protein, His-Tagged
Cat.No. : | RFL24935CF |
Product Overview : | Recombinant Full Length Candida glabrata Spore membrane assembly protein 2(SMA2) Protein (Q6FKI5) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MLIVKRFILWVLLFFMAITQLLLYLPDFSCSISTGLPLCTPQFNVNIVTGSRTTKDFVSS VRQFLRLISYLAIDMGWSKYLADPHIYNEENLVDTFDTDNLFKINYFGFCKKTSGKTKYC VANGDCGMDVLGILVRDVGLQLGRLTQRYENNTRILGDSLVFTYHLGLSSMRKFLRNDNY RNNAFSKLLLATDDQPYSNTRIKNYAKGVTVAYTLVVVNKIMFYMHLAEITISAAFVVAV LGFGFVLIFGKHHTIMPLLLKGWGSVLMVSSTSSYLATIVYLGTLKLLEPTEMLDTQSQV AGHVLNNDTHSNNWDLLQTTVGSGFVISCFRYIVQCLMLPLVFIAANRYTKAKDFLPAGT EELIKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMA2 |
Synonyms | SMA2; CAGL0L11286g; Spore membrane assembly protein 2 |
UniProt ID | Q6FKI5 |
◆ Recombinant Proteins | ||
RFL22635SF | Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged | +Inquiry |
TRPC2-1158HFL | Recombinant Human TRPC2 protein, His&Flag-tagged | +Inquiry |
RPL36AL-7745M | Recombinant Mouse RPL36AL Protein, His (Fc)-Avi-tagged | +Inquiry |
CTLA4-2232HAF647 | Recombinant Human CTLA4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CAPS-10711H | Recombinant Human CAPS, His-tagged | +Inquiry |
◆ Native Proteins | ||
PHAL-01P | Active Native Phaseolus vulgaris lectin L Protein | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGB-6255HCL | Recombinant Human FGB 293 Cell Lysate | +Inquiry |
PTGS1-2706HCL | Recombinant Human PTGS1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Gallbladder-196H | Human Gallbladder Membrane Lysate | +Inquiry |
C3orf17-244HCL | Recombinant Human C3orf17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMA2 Products
Required fields are marked with *
My Review for All SMA2 Products
Required fields are marked with *
0
Inquiry Basket