Recombinant Full Length Candida Glabrata Mitochondrial Inner Membrane Magnesium Transporter Lpe10(Lpe10) Protein, His-Tagged
Cat.No. : | RFL35661CF |
Product Overview : | Recombinant Full Length Candida glabrata Mitochondrial inner membrane magnesium transporter LPE10(LPE10) Protein (Q6FJD1) (38-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (38-397) |
Form : | Lyophilized powder |
AA Sequence : | TAALLLQKNLIQRNNMLYGHGSGTIRCTVFDAGGNIVSPALDIKREELVAKHGLLPRDLR KIEKSRKNDLVPSFLVRKNGILVSLATIKTLIKPDMVIVFDSFGSLNSTSHKAFLNSLKL RLQNLDMVELKKDPLPYEFRALESIFISALSNLTSEMNVQVTICKGILQDLEYSITRDKL KFLLGQNKKLSNFYKKTVLIRDMLDDLLEQSDVLCSMYLSDLKNGVEHKDDDHSEIEMLL ETYHNHLDEIVQITENIISNVKTTEEIINIILDSNRNQLMLLGIRFSIGMLSLGGPIFIG SLYGMNLENFIEETDYGFIAASAIGMISLGALYFYSIKHLHKLQKMSLFNYTNYARDVKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPE10 |
Synonyms | LPE10; CAGL0M07249g; Mitochondrial inner membrane magnesium transporter LPE10 |
UniProt ID | Q6FJD1 |
◆ Recombinant Proteins | ||
EUTD-0468B | Recombinant Bacillus subtilis EUTD protein, His-tagged | +Inquiry |
RFL8030VF | Recombinant Full Length Vulpes Corsac Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
GUCY2C-1500C | Active Recombinant Cynomolgus GUCY2C protein, Fc-tagged | +Inquiry |
TPH1-6515C | Recombinant Chicken TPH1 | +Inquiry |
DNMBP-28369TH | Recombinant Human DNMBP, His-tagged | +Inquiry |
◆ Native Proteins | ||
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
IgG-351C | Native Cat IgG | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB1BP3-879HCL | Recombinant Human ITGB1BP3 cell lysate | +Inquiry |
ZNF558-52HCL | Recombinant Human ZNF558 293 Cell Lysate | +Inquiry |
Liver-280H | Human Liver (RT Lobe) Cytoplasmic Lysate | +Inquiry |
PDE1C-001HCL | Recombinant Human PDE1C cell lysate | +Inquiry |
TSR1-698HCL | Recombinant Human TSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPE10 Products
Required fields are marked with *
My Review for All LPE10 Products
Required fields are marked with *
0
Inquiry Basket