Recombinant Human DNMBP, His-tagged

Cat.No. : DNMBP-28369TH
Product Overview : Recombinant fragment, corresponding to amino acids 1400-1577 of Human DNMBP with N terminal His tag; 178 amino acids, 44kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1400-1577 a.a.
Description : DNMBP belongs to the DBL (MIM 311030) family of guanine nucleotide exchange factors and plays a role in the regulation of cell junctions (Otani et al.
Conjugation : His
Tissue specificity : Detected in heart, brain, lung, liver, skeletal muscle, kidney and pancreas.
Form : Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKQPQDASPPPKECDQGTLSASLNPSNSESSPSRCPSDPD STSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGY SVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGN QVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWW LAEVNGKKGYVPSNYIRKTEYT
Sequence Similarities : Contains 1 BAR domain.Contains 1 DH (DBL-homology) domain.Contains 6 SH3 domains.
Gene Name DNMBP dynamin binding protein [ Homo sapiens ]
Official Symbol DNMBP
Synonyms DNMBP; dynamin binding protein; dynamin-binding protein; ARHGEF36; KIAA1010; scaffold protein TUBA; Tuba;
Gene ID 23268
mRNA Refseq NM_015221
Protein Refseq NP_056036
MIM 611282
Uniprot ID Q6XZF7
Chromosome Location 10q24.31
Pathway Regulation of CDC42 activity, organism-specific biosystem;
Function Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNMBP Products

Required fields are marked with *

My Review for All DNMBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon