Recombinant Full Length Rhizobium Meliloti Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL26667RF |
Product Overview : | Recombinant Full Length Rhizobium meliloti Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q92NU9) (1-647aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-647) |
Form : | Lyophilized powder |
AA Sequence : | MAPLISLQDVSKTYFNGDIAVEVLHHISLDIEAGEFVAIIGQSGSGKSTLMNILGCLDQP TSGSYFIEGENVSGFDSDELAALRRRTFGFIFQSYNLIPTASARENVEVPAVYAGVSARD RHDRAEALLQSLKLGERIDHRPNQLSGGQQQRVSIARALMNGGRVILADEPTGALDSQSG DEVMRLLRDMNENGHTVIVITHSREVAAQADRLIEISDGHIVADRSKKRRSNRDAAVGLA QRTREGFAAIADVSEAVKMALRALRANLFRTILTLLGIVIGVGSVVAMLAIGTGAQNSVL DRISSMGSDLLVVRPSMANFRGSAGGTNVTLVPADADAITELANVAFAVPEMTSTVTLRR GNIDYQTTANGTVPQFTEAKSWKIGRGEFINRNDMETYAPVAVLGETVVKTLFPEGSDPI GQYVLVNKIPFQVIGVMSGMGASAGGNDQDDVVLVPLTTGSMRLFGQRNIRTITVKVQDA SAIDLTQERIQALLNERHRKDDTQITNMSSVREAFTETSNTMKFFLGSVAAISLLVGGIG VMNIMLVSVSERTREIGVRMATGARERDILVQFIVEALVVSAIGGAIGVVAGLSTGYAAK AFGMPVSFTPGPVALAFACAFLTGLLFGYLPARNASRLQPAVALSAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; R02071; SMc04351; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q92NU9 |
◆ Recombinant Proteins | ||
PTGES-1544H | Recombinant Human PTGES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EREG-004H | Active Recombinant Human EREG Protein | +Inquiry |
C1QTNF9-238H | Recombinant Human C1QTNF9, His-tagged | +Inquiry |
MIIP-5340H | Recombinant Human MIIP Protein, GST-tagged | +Inquiry |
ABCC2-1100M | Recombinant Mouse ABCC2 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-343M | Native MONKEY IgG | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEC2-4541HCL | Recombinant Human MAGEC2 293 Cell Lysate | +Inquiry |
PBLD-3409HCL | Recombinant Human PBLD 293 Cell Lysate | +Inquiry |
PRSS58-726HCL | Recombinant Human TRYX3 293 Cell Lysate | +Inquiry |
THOC4-1093HCL | Recombinant Human THOC4 293 Cell Lysate | +Inquiry |
RNF216-2282HCL | Recombinant Human RNF216 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket