Recombinant Full Length Brucella Melitensis Biotype 1 Type Iv Secretion System Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL3796BF |
Product Overview : | Recombinant Full Length Brucella melitensis biotype 1 Type IV secretion system protein virB10(virB10) Protein (Q8YDZ0) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella melitensis biotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NPHSYKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDT PAKDDVLDKSASALMVVTKSSGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTD ARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTI SGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGA LMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEE IGIYIARDLDFSSVYDVKPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; BMEII0034; Type IV secretion system protein virB10 |
UniProt ID | Q8YDZ0 |
◆ Recombinant Proteins | ||
Ncf4-466M | Recombinant Mouse Ncf4 Protein, His-tagged | +Inquiry |
OTC-325H | Recombinant Human OTC Protein, His-tagged | +Inquiry |
PSMB4-2018H | Recombinant Human PSMB4, GST-tagged | +Inquiry |
CCDC63-0567H | Recombinant Human CCDC63 Protein, GST-Tagged | +Inquiry |
NSP2-1037H | Recombinant SARS-CoV-2 NSP2 Protein (A181-G818), His tagged | +Inquiry |
◆ Native Proteins | ||
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETBP1-1587HCL | Recombinant Human SETBP1 cell lysate | +Inquiry |
MMP10-4282HCL | Recombinant Human MMP10 293 Cell Lysate | +Inquiry |
IGFBP4-2926HCL | Recombinant Human IGFBP4 cell lysate | +Inquiry |
WFDC9-317HCL | Recombinant Human WFDC9 293 Cell Lysate | +Inquiry |
FOXO4-6147HCL | Recombinant Human FOXO4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket