Recombinant Full Length Brucella Abortus Biovar 1 Type Iv Secretion System Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL2743BF |
Product Overview : | Recombinant Full Length Brucella abortus biovar 1 Type IV secretion system protein virB10(virB10) Protein (P0C531) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella Abortus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDT PAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGT LLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVL LIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSH FWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPT LYKNQGEEIGIYIARDLDFSSVYDVKPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; BruAb2_0060; Type IV secretion system protein virB10 |
UniProt ID | P0C531 |
◆ Recombinant Proteins | ||
Sp3-6061M | Recombinant Mouse Sp3 Protein, Myc/DDK-tagged | +Inquiry |
TFEC-5686R | Recombinant Rat TFEC Protein, His (Fc)-Avi-tagged | +Inquiry |
RB1-195H | Recombinant Human RB1 protein | +Inquiry |
UBE2C-899H | Active Recombinant Human UBE2C Protein, Met & His-tagged | +Inquiry |
EPHX4-2820M | Recombinant Mouse EPHX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5B-292HCL | Recombinant Human WNT5B 293 Cell Lysate | +Inquiry |
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
TRAF2-824HCL | Recombinant Human TRAF2 293 Cell Lysate | +Inquiry |
IL13RA1-1443RCL | Recombinant Rat IL13RA1 cell lysate | +Inquiry |
HNRNPH3-5444HCL | Recombinant Human HNRNPH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket