Recombinant Human RB1 protein

• Cat.No.: RB1-195H
• Product Overview: Recombinant Human RB1 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 146
• Description: Rb encoded by the RB1 gene in humans, is expressed by retina and belongs to the etinoblastoma-associated protein family. The hole protein consists of 928 a.a. and the rHuRb fragment occupies sequence of 792-929 a.a.. Rb is a key regulator of entry into cell division that acts as a tumor suppressor. It has many functions, for example, promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C, and acts as a transcription repressor of E2F1 target genes and so on. The rHuRb is the region that rich of modified residue like phosphothreonine and N6-acetyllysine.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Molecular Mass: Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
• AA Sequence: MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
• Endotoxin: Less than 1 EU/μg of rHuRb137, His as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: RB1
• Official Symbol: RB1
• Synonyms: RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb
• Gene ID: 5925
• mRNA Refseq: NM_000321
• Protein Refseq: NP_000312
• MIM: 614041
• UniProt ID: P06400