Recombinant Full Length Brucella Abortus Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL30751BF |
Product Overview : | Recombinant Full Length Brucella abortus Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q2YQ73) (1-599aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella Abortus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-599) |
Form : | Lyophilized powder |
AA Sequence : | MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTYEFPNSGQGVYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKVTQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; cgt; BAB1_1017; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q2YQ73 |
◆ Recombinant Proteins | ||
ICOSLG-540H | Active Recombinant Human ICOSLG, His-tagged | +Inquiry |
FAM78A-4639HF | Recombinant Full Length Human FAM78A Protein, GST-tagged | +Inquiry |
Il13-1661R | Recombinant Rat Il13 Protein, His-tagged | +Inquiry |
ADRB3-281C | Recombinant Cynomolgus ADRB3 Protein, His-tagged | +Inquiry |
HOMER1-3687HF | Recombinant Full Length Human HOMER1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
AMBP-27H | Native Human AMBP | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX39A-7008HCL | Recombinant Human DDX39 293 Cell Lysate | +Inquiry |
GSTM4-5711HCL | Recombinant Human GSTM4 293 Cell Lysate | +Inquiry |
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
FIP1L1-276HCL | Recombinant Human FIP1L1 lysate | +Inquiry |
SLC35F6-110HCL | Recombinant Human SLC35F6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket