Recombinant Full Length Bovine Transmembrane Protein Ensp00000340100 Homolog Protein, His-Tagged
Cat.No. : | RFL10998BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein ENSP00000340100 homolog Protein (Q32LN6) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTFILWDVGYPFYTYGSIIIIALIIWQVKKNHRGLKLGPNRNCCRRHQKVKQRAKEK TPRARRHSRKEADKPLELLSIMRSQGWLPQEGSVRRLLCADPCCQICNSVALEIQQLISG ETTLTTPTSSGPSQGSSCLEVLSMSSLSFDQSQESLPFKQLSLPSATRTVSQLTNQKSVT QSAAKSATKPATKSVSAISIRQYWAGHQQLRQECRGPELPLDAGALSSSSVEEPRIPVNQ HVKKKSNSEGILKKQEAVEADLGNKLKHFTQWINPDMKGQGRKECILRCKDEKVAKTKTK KAEKSPPSTKRPMKGAKLEKEEGFFDALQCLDSEFQRQSMESVRSSQSCFLPLSSGSSKR SPLLTCATQPENPSHVSVSTSAEGTCLPQESTQSRKKELRGSQTSASS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAM205C |
Synonyms | FAM205C; Protein FAM205C |
UniProt ID | Q32LN6 |
◆ Native Proteins | ||
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
LH-839H | Active Native Human Luteinizing Hormone | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
Lectin-1745S | Active Native Sambucus Nigra Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-56410RH | Rabbit Anti-Human PDCD4 Polyclonal Antibody | +Inquiry |
PHACTR4-3244HCL | Recombinant Human PHACTR4 293 Cell Lysate | +Inquiry |
HA-2604HCL | Recombinant H3N2 HA cell lysate | +Inquiry |
ZBTB9-209HCL | Recombinant Human ZBTB9 293 Cell Lysate | +Inquiry |
ARCN1-8763HCL | Recombinant Human ARCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM205C Products
Required fields are marked with *
My Review for All FAM205C Products
Required fields are marked with *
0
Inquiry Basket