Recombinant Full Length Bovine Motile Sperm Domain-Containing Protein 3(Mospd3) Protein, His-Tagged
Cat.No. : | RFL9173BF |
Product Overview : | Recombinant Full Length Bovine Motile sperm domain-containing protein 3(MOSPD3) Protein (Q3T033) (1-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-235) |
Form : | Lyophilized powder |
AA Sequence : | MRRGAPQDQELVGPGAPGRGSRGAPPPSGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP TGAVLRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPHPRNYDVQDRFRIELSEEG TEGRVVGRKDITSVLRAPAYPLELQGQSDPTPHPEPHSWTASSTAQPFPENPHPQLATSS FLLFLLMGTVSVAFLLLPLQDELGSQLPQILHVSLGQKLVAAYVLGLLTMVFLRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MOSPD3 |
Synonyms | MOSPD3; Motile sperm domain-containing protein 3 |
UniProt ID | Q3T033 |
◆ Recombinant Proteins | ||
MOSPD3-6317HF | Recombinant Full Length Human MOSPD3 Protein, GST-tagged | +Inquiry |
MOSPD3-425H | Recombinant Human MOSPD3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MOSPD3-5489H | Recombinant Human MOSPD3 Protein, GST-tagged | +Inquiry |
Mospd3-4120M | Recombinant Mouse Mospd3 Protein, Myc/DDK-tagged | +Inquiry |
RFL9173BF | Recombinant Full Length Bovine Motile Sperm Domain-Containing Protein 3(Mospd3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOSPD3-4243HCL | Recombinant Human MOSPD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOSPD3 Products
Required fields are marked with *
My Review for All MOSPD3 Products
Required fields are marked with *
0
Inquiry Basket