Recombinant Human MOSPD3 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: MOSPD3-425H
• Product Overview: MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq, Jul 2008]
• Molecular Mass: 25.5 kDa
• AA Sequence: MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MOSPD3 motile sperm domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: MOSPD3
• Synonyms: MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30
• Gene ID: 64598
• mRNA Refseq: NM_023948
• Protein Refseq: NP_076438
• MIM: 609125
• UniProt ID: O75425