Recombinant Full Length Human MOSPD3 Protein, GST-tagged

• Cat.No.: MOSPD3-6317HF
• Product Overview: Human MOSPD3 full-length ORF ( NP_076438.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 235 amino acids
• Description: This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq
• Molecular Mass: 51.9 kDa
• AA Sequence: MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MOSPD3 motile sperm domain containing 3 [ Homo sapiens ]
• Official Symbol: MOSPD3
• Synonyms: MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30
• Gene ID: 64598
• mRNA Refseq: NM_001040097
• Protein Refseq: NP_001035186
• MIM: 609125
• UniProt ID: O75425