Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial(Cox4I1) Protein, His-Tagged
Cat.No. : | RFL22307BF |
Product Overview : | Recombinant Full Length Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1) Protein (P00423) (23-169aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-169) |
Form : | Lyophilized powder |
AA Sequence : | AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELY RLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQT KRMLDMKVAPIQGFSAKWDYDKNEWKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COX4I1 |
Synonyms | COX4I1; COX4; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1 |
UniProt ID | P00423 |
◆ Recombinant Proteins | ||
COX4I1-419H | Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged | +Inquiry |
COX4I1-12731Z | Recombinant Zebrafish COX4I1 | +Inquiry |
COX4I1-987R | Recombinant Rhesus monkey COX4I1 Protein, His-tagged | +Inquiry |
COX4I1-812R | Recombinant Rhesus Macaque COX4I1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22307BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 4 Isoform 1, Mitochondrial(Cox4I1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *
0
Inquiry Basket