Recombinant Full Length Borrelia Burgdorferi Uncharacterized Protein Bb_0752 (Bb_0752) Protein, His-Tagged
Cat.No. : | RFL8841BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Uncharacterized protein BB_0752 (BB_0752) Protein (O51693) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MKNKENEVLNLTLNLTIIFLIFCNISIXIFKIDFTKHKAFTISKVTKNLFSSANETIYIT YYNSGSLENYFAFPNQIKNFLISFSDASKCKVIYKEIDADKISTPLEHIGIPSQQIDLRD INQLSILKIYSGIEIIYEGKREVIPVVTEISNLEYDLANGLDKLINNTKKVLGLAFGDST LKEAHKNFSEIMKKAFGIEIKEIDLKTEKLEDIRKDINGLFIIGAKEIDEEIAKKIDDFI VNDGKIFVATSTIDYNPQNPYGITPIKSSLFDLFESYGIKYNDNIILDKRAPTIFLGGNF QTYYPWILIDKSNIVKKDMPLLKNFYTATIPWSSSLELIKKDETEVKFLPLFASSKQSWQ VKEPNLSNISLNAFEVPNKFEENKTKILGYAIEGKIKSPYKDQYSKNSKIILTGSSMIFS DYMYNGSPSNFELSGRISDYLMQKEEFFNIKSREVRAKLKFASSSNEMVNAKFSLIIVNL IILPTIILIFGLVRFTRKRKAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB_0752 |
Synonyms | BB_0752; Uncharacterized protein BB_0752 |
UniProt ID | O51693 |
◆ Recombinant Proteins | ||
BMI1-1371H | Recombinant Human BMI1 Protein (Glu152-Ile289), His tagged | +Inquiry |
CSF3R-555H | Recombinant Human CSF3R Protein (Glu25-Pro622), C-6×His-tagged | +Inquiry |
ANKRD33-1666M | Recombinant Mouse ANKRD33 Protein | +Inquiry |
DCLK2-4351M | Recombinant Mouse DCLK2 Protein | +Inquiry |
RFL11013SF | Recombinant Full Length Sinorhizobium Medicae Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHTF1-1348HCL | Recombinant Human PHTF1 cell lysate | +Inquiry |
SMPD2-614HCL | Recombinant Human SMPD2 lysate | +Inquiry |
ARNT-8692HCL | Recombinant Human ARNT 293 Cell Lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
RABL5-2567HCL | Recombinant Human RABL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BB_0752 Products
Required fields are marked with *
My Review for All BB_0752 Products
Required fields are marked with *
0
Inquiry Basket