Recombinant Full Length Methylococcus Capsulatus Apolipoprotein N-Acyltransferase(Lnt) Protein, His-Tagged
Cat.No. : | RFL23167MF |
Product Overview : | Recombinant Full Length Methylococcus capsulatus Apolipoprotein N-acyltransferase(lnt) Protein (Q608N5) (1-504aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylococcus capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-504) |
Form : | Lyophilized powder |
AA Sequence : | MKAMLLALTGGILLPFAFAPFGYALVAPLSLALLFRVWLNASPSKAALYGYLFGLGQFGI GVSWVFVSMYEYGGSDVFSAAGLTALFVAYLALFPALAGWLGVKAGGGSILVRTLLVFPA AWVVTEWLRGWLFSGFPWLQIGYSQTDTGLRSIAPVFGVFGVGWLLAVLAGLLLSAWLLD RRGRRFALLGAAVVLVGSTQFAKVQWTHPAGDPIRVTLLQGNVPQDQKWRPEAKTTTVQM YVDMTRQHWDSRLIIWPETAVPAFYQQVAESFLAPLEAEARQHGVDVLVGVPYYEAQGNR YYNALVTLGAKPGRYFKRHLVPFGEFLPLRPVLAFVLDILQIPLADFTAGAHRQTLLQAA GYPLIASICYEDIFGQESLTGLPEGAYLVNVTNDAWFGDSFAPHQHWQKARMRALETGRY MLRATNTGVTGIIDAGGRPVAVAPMFEREALTGMMQPMAGATPYALWGDWPAIGLCAGIV GICFARRRRNASSHQGRQAEPGRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt |
Synonyms | lnt; MCA1455; Apolipoprotein N-acyltransferase; ALP N-acyltransferase |
UniProt ID | Q608N5 |
◆ Native Proteins | ||
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KISS1-4937HCL | Recombinant Human KISS1 293 Cell Lysate | +Inquiry |
C12orf10-8330HCL | Recombinant Human C12orf10 293 Cell Lysate | +Inquiry |
DBNL-7063HCL | Recombinant Human DBNL 293 Cell Lysate | +Inquiry |
HBE1-316HCL | Recombinant Human HBE1 lysate | +Inquiry |
HMGB4-5476HCL | Recombinant Human HMGB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt Products
Required fields are marked with *
My Review for All lnt Products
Required fields are marked with *
0
Inquiry Basket