Recombinant Full Length Bordetella Avium Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL5225BF |
Product Overview : | Recombinant Full Length Bordetella avium Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2KVS6) (1-655aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bordetella avium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-655) |
Form : | Lyophilized powder |
AA Sequence : | MSEPLIELRDVWREFAAGDQVVAVLREVNLSIQAGEMVAIVGASGSGKSTLMNILGCLDR PSRGGYRVDGRETARMDPDELAELRREHFGFIFQRYHLLADLSAQANVEMPAVYAGMASG PRHERAAALLRRLGLSERLDYRPGQLSGGQQQRVSIARALMNGGRIILADEPTGALDTQT GQEVLRILKELNAAGHTIVLVTHDMSVARHARRIIEISDGRIVSDQARPDAPPLDALAGD EGPEAPRPAPQPLRAWLDRGSEALRMALLAMNAHRLRTCLTMLGIIIGIAAVVSVVALGA GSRQMILDDISAMGTNTVDVLPGKHFGDEKAASIRTLVAADVEALARQPYADSVSPEVTT SATLRYRNVSVNGTVQGVGEQYPRVRGVRIAQGQFFDAAAVARRGQDVVIDNNTRKALFG NHTDPIGQVIFIGAVPARVIGVTRPQETLFGNADALHVWIPYTTALSRILGQQHLRSITV RVNDSTPPKAAEAAITKLMLQRHGTQDFFVFNTDTIRQTVERTTATLTLLVSMIAVISLV VVGIGVMNIMLVSVTERTREIGVRMAVGARRSDIMQQFLIEAVLVCLIGGVLGILLSLSI GVLVSQATRGAFQMLYSSGSMVLAFVCSTLIGVAFGFLPARSAARLDPVESLARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; BAV2813; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2KVS6 |
◆ Recombinant Proteins | ||
MGAT4A-5534M | Recombinant Mouse MGAT4A Protein, His (Fc)-Avi-tagged | +Inquiry |
HARS2-1044H | Recombinant Human HARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
XCL2-001H | Active Recombinant Human XCL2, MIgG2a Fc-tagged | +Inquiry |
CCND2-2612H | Recombinant Human CCND2 protein, His & T7-tagged | +Inquiry |
BMP8B-283H | Active Recombinant Human BMP8B Protein (Ala264-His402), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
TF-01B | Native Bovine TF Protein | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF28-540HCL | Recombinant Human ARHGEF28 lysate | +Inquiry |
DGKG-6955HCL | Recombinant Human DGKG 293 Cell Lysate | +Inquiry |
Fetal Temporal Lobe-169H | Human Fetal Temporal Lobe Lysate | +Inquiry |
AKT3-001MCL | Recombinant Mouse AKT3 cell lysate | +Inquiry |
PYGB-1449HCL | Recombinant Human PYGB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket