Recombinant Full Length Aggregatibacter Actinomycetemcomitans Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL804AF |
Product Overview : | Recombinant Full Length Aggregatibacter actinomycetemcomitans Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q2EHL8) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aggregatibacter Actinomycetemcomitans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MNIIEIKQLNRYFGEGENRVHVLKDISLSIERGDFVAIMGQSGSGKSTLMNIIGCLDTAT GGSSKIDGKETIELTNDQLSDLRSQKFGFIFQRYNLLSSLTAAENVALPAIYAGMPQSQR LERAKQLLEKLGLGDKWQNKPNQLSGGQQQRVSIARALMNGGEIILADEPTGALDSHSGE NVMEILRQLHEEGHTIIMVTHDKHIAASANRIIEIKDGEIISDTQKRQVKSAVKNPSVFK GRFGFSKDQLMEAFRMSVSAIVAHKMRSLLTMLGIIIGITSVVSVVALGNGSQQKILENI RGIGTNTMTIFNGNGFGDRRSRHIQNLKISDANTLSKQSYIQSVTPNTSSSGILVVGNKS FTSANLYGIGEQYFDVEGLKLKQGRLLTEDDVDQSNQVVVLDESAKKAIFANENPLGKTV IFNKRPFRVIGVVSDQQLGGFPGNSLNLYSPYSTVLNKITGGSRIGSITVKISDDVNSTV AEKSLTELLKSLHGKKDFFIMNSDTIKQTIENTTGTMKLLISSIAFISLIVGGIGVMNIM LVSVTERTKEIGVRMAIGARQINILQQFLIEAVLICLIGGVAGILLSVLIGVLFNSFITD FSMDFSTASIVTAVLFSTLIGVLFGYMPAKKAAELNPITALAQE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q2EHL8 |
◆ Recombinant Proteins | ||
WNT8A-2361H | Recombinant Human WNT8A Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX2-6568C | Recombinant Chicken PITX2 | +Inquiry |
MAL2-1927C | Recombinant Chicken MAL2 | +Inquiry |
CHTOP-699R | Recombinant Rhesus Macaque CHTOP Protein, His (Fc)-Avi-tagged | +Inquiry |
CD22-561HAF647 | Active Recombinant Human CD22 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Native Proteins | ||
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
ELN-01H | Active Native Human ELN Protein | +Inquiry |
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adrenal-552M | MiniPig Adrenal Lysate, Total Protein | +Inquiry |
UBE2E2-582HCL | Recombinant Human UBE2E2 293 Cell Lysate | +Inquiry |
HCT-116-032HCL | Human HCT-116 Whole Cell Lysate | +Inquiry |
MRPL14-4195HCL | Recombinant Human MRPL14 293 Cell Lysate | +Inquiry |
UBA3-604HCL | Recombinant Human UBA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket