Recombinant Full Length Bombyx Mori Nuclear Polyhedrosis Virus Occlusion-Derived Virus Envelope Protein E56(Odvp6E) Protein, His-Tagged
Cat.No. : | RFL8234BF |
Product Overview : | Recombinant Full Length Bombyx mori nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(ODVP6E) Protein (O92500) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | BOMMOnuclear polyhedrosis virus (BmNPV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MSFFTNLRRVNKLYPNQASFLADNTRLLTSTPAGFTNVLNAPSVRNLGNNRYQPGYQLSN NRFVSTSDINRITRNNDVPNIRNVFQGISDPQINSLRQLRRMDNVPDFHYHTKQTRSNAV RQNFPETNVRTPEGVQNALQQNPRLHNHMRTLKVAGVGILLAGGGYLLFTASTLVQDIIN AINRTGGSYYVQGRNAGENVESCLLLQRTCRQDRNLAQSDVNICSRDPLLANDSPLLTNM CQGFNYETEKTVCRGSNPAANPNSPQYVDISDLPAGQTIMCIEPYSFSDLVGDLGLDWLL GREGLVGKSSNSSDGIRNKIMPIIMMIGAVLFLGLILYFIYRYMTKGGGGGGGSGGAPTP IVIMQHPASTTAPRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ODVP6E |
Synonyms | ODVP6E; Occlusion-derived virus envelope protein E56; ODV-E56; ODVP-6E |
UniProt ID | O92500 |
◆ Native Proteins | ||
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASNS-8649HCL | Recombinant Human ASNS 293 Cell Lysate | +Inquiry |
CYP51A1-7100HCL | Recombinant Human CYP51A1 293 Cell Lysate | +Inquiry |
C6orf48-7981HCL | Recombinant Human C6orf48 293 Cell Lysate | +Inquiry |
ICA1L-5314HCL | Recombinant Human ICA1L 293 Cell Lysate | +Inquiry |
AXIN2-8554HCL | Recombinant Human AXIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ODVP6E Products
Required fields are marked with *
My Review for All ODVP6E Products
Required fields are marked with *
0
Inquiry Basket