Recombinant Full Length Shewanella Sp. Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL15984SF |
Product Overview : | Recombinant Full Length Shewanella sp. Macrolide export ATP-binding/permease protein MacB(macB) Protein (A0L0V9) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MSKPLLEVSACYRSFQAGEQQLTVLKDINLSIARGEMVAIVGASGSGKSTLMNILGCLDK PSKGSYFIDGQDTSQMDVDELAKLRREHFGFIFQRYHLLGDLNAVGNVEVPAVYAGKDRL ERRERAESLLSRLGLGERLDHKPNQLSGGQQQRVSVARALMNGGDVILADEPTGALDSHS GEEMMRLLQELHREGQTIIIVTHDMHVAQHADRIIEIKDGVIISDEPNPASNIAAAPKTE VIPAKTKARARVAAWDRYAEALKMALLAMSTHRLRTFLTMLGIIIGIASVVSVVALGEGS QREILKSISSMGTNTIDIRPGSGFGDRRSARVRTLTASDANALKNLPYVDSVTPSIGSSA TVRYGNKAVTATVNGVGPEFFRVRGYELAQGQFWDDDSVNALAQDAVIDENTRKQLFPNS SGAMNSAIGEVIFLGDLPVRIIGVTQPKESAFGNSDALNVWVPYTTVSGRMVGKKYLDGI TVRLDESVPSNAAEQGIISLLKMRHGTQDFFTINTDTIRQNIEKTTATMTLLISAIAVIS LVVGGIGVMNIMLVSVTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGALGVALAY LIGVVFAQAGGSFQMIYSTTSIVAAFACSTLIGVLFGFLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Shewana3_3455; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | A0L0V9 |
◆ Recombinant Proteins | ||
IL17A & IL17F-01H | Recombinant Human IL17A & IL17F protein, His-Avi-tagged | +Inquiry |
Lman1-3796M | Recombinant Mouse Lman1 Protein, Myc/DDK-tagged | +Inquiry |
HA-1061I | Recombinant H3N2 (A/Hong Kong/4801/2014) HA Protein, His-tagged | +Inquiry |
TMPRSS2-70H | Recombinant Human TMPRSS2 protein, GST-tagged | +Inquiry |
TOM1L2-17216M | Recombinant Mouse TOM1L2 Protein | +Inquiry |
◆ Native Proteins | ||
FTH1-28155TH | Native Human FTH1 | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRA2C-8999HCL | Recombinant Human ADRA2C 293 Cell Lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
CENPL-7581HCL | Recombinant Human CENPL 293 Cell Lysate | +Inquiry |
KCNQ1-5020HCL | Recombinant Human KCNQ1 293 Cell Lysate | +Inquiry |
GPR156-5794HCL | Recombinant Human GPR156 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket