Recombinant Full Length Bacillus Licheniformis Multidrug Resistance Protein Ebrb(Ebrb) Protein, His-Tagged
Cat.No. : | RFL4884BF |
Product Overview : | Recombinant Full Length Bacillus licheniformis Multidrug resistance protein EbrB(ebrB) Protein (Q65JB2) (1-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus Licheniformis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-119) |
Form : | Lyophilized powder |
AA Sequence : | MKGMIFLAAAILSEVFGSTMLKLSEGFSAPLPAAGVIIGFAASFTFLSFSLKTLPLSAAY ATWAGTGTALTAAIGHFIFQEPFNLKTLIGLTLIIGGVFLLNSKRTEAADQKAQLTIEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebrB |
Synonyms | ebrB; BLi01958; BL00457; Multidrug resistance protein EbrB |
UniProt ID | Q65JB2 |
◆ Recombinant Proteins | ||
CD28-5643C | Recombinant Canine CD28 protein, mFc-tagged | +Inquiry |
Met-194HAF555 | Recombinant Human Met Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
RFL21847SF | Recombinant Full Length Salmonella Paratyphi A P-Hydroxybenzoic Acid Efflux Pump Subunit Aaea(Aaea) Protein, His-Tagged | +Inquiry |
ENPP1&ENPP2-2856H | Recombinant Human ENPP1&ENPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRM1-14524M | Recombinant Mouse RRM1 Protein | +Inquiry |
◆ Native Proteins | ||
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC45-7649HCL | Recombinant Human CDC45 293 Cell Lysate | +Inquiry |
ORAI3-459HCL | Recombinant Human ORAI3 lysate | +Inquiry |
C8orf40-7952HCL | Recombinant Human C8orf40 293 Cell Lysate | +Inquiry |
HeLa-003HCL | Human HeLa Whole Cell Lysate | +Inquiry |
C17orf80-8228HCL | Recombinant Human C17orf80 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebrB Products
Required fields are marked with *
My Review for All ebrB Products
Required fields are marked with *
0
Inquiry Basket