Recombinant Full Length Bacillus Subtilis Multidrug Resistance Protein Ebrb(Ebrb) Protein, His-Tagged
Cat.No. : | RFL16902BF |
Product Overview : | Recombinant Full Length Bacillus subtilis Multidrug resistance protein EbrB(ebrB) Protein (P0CW82) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus subtilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-117) |
Form : | Lyophilized powder |
AA Sequence : | MRGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGFLSAFTFLSFSLKTIDLSSAY ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAHAEDKKQTACE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebrB |
Synonyms | ebrB; BSU17290; Multidrug resistance protein EbrB |
UniProt ID | P0CW82 |
◆ Recombinant Proteins | ||
ARIH1-10147Z | Recombinant Zebrafish ARIH1 | +Inquiry |
RFL25360LF | Recombinant Full Length Clostridium Phytofermentans Cobalt Transport Protein Cbim(Cbim) Protein, His-Tagged | +Inquiry |
DDX6-2280M | Recombinant Mouse DDX6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NQO2-2055H | Recombinant Human NAD(P)H Dehydrogenase, Quinone 2, His-tagged | +Inquiry |
PRKACB-3420R | Recombinant Rhesus Macaque PRKACB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
Type II Collagen-01C | Native Chicken Type II Collagen | +Inquiry |
PLAU-8456H | Active Native Human PLAU | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA60-3964HCL | Recombinant Human NAT15 293 Cell Lysate | +Inquiry |
RAB40AL-2593HCL | Recombinant Human RAB40AL 293 Cell Lysate | +Inquiry |
MIS18A-104HCL | Recombinant Human MIS18A lysate | +Inquiry |
ASB9-8657HCL | Recombinant Human ASB9 293 Cell Lysate | +Inquiry |
MRPS30-1135HCL | Recombinant Human MRPS30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebrB Products
Required fields are marked with *
My Review for All ebrB Products
Required fields are marked with *
0
Inquiry Basket