Recombinant Full Length Bacillus Cereus Cardiolipin Synthase 1(Cls1) Protein, His-Tagged
Cat.No. : | RFL22170BF |
Product Overview : | Recombinant Full Length Bacillus cereus Cardiolipin synthase 1(cls1) Protein (Q81I00) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus cereus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGISFVIFIENRSPQSTLA WFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELLLTVPLNER SIHLTEVIQKFGGGPAADRTTTKLLTNGDQTFSEILRAIEQAKHHIHIQYYIYKSDEIGT KVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKIEGKALYKLQAIFLEDWLY ASSGLNTYSWDQFMNRQYFPGKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSI WIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYS YKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIISVLYESKTVHDIKRDFEEDFKHS TEIKWNSFQKRSIKKRILESFMRLISPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls1 |
Synonyms | cls1; BC_0626; Cardiolipin synthase 1; CL synthase 1 |
UniProt ID | Q81I00 |
◆ Recombinant Proteins | ||
Agxt2-1031R | Recombinant Rat Agxt2 protein, His & T7-tagged | +Inquiry |
Arid4b-3681M | Recombinant Mouse Arid4b, His-tagged | +Inquiry |
IRF8-5742HF | Recombinant Full Length Human IRF8 Protein, GST-tagged | +Inquiry |
HAUS1-3833HF | Recombinant Full Length Human HAUS1 Protein, GST-tagged | +Inquiry |
DCAF6-4338M | Recombinant Mouse DCAF6 Protein | +Inquiry |
◆ Native Proteins | ||
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL53-4156HCL | Recombinant Human MRPL53 293 Cell Lysate | +Inquiry |
CABS1-8026HCL | Recombinant Human C4orf35 293 Cell Lysate | +Inquiry |
CYP4F11-7103HCL | Recombinant Human CYP4F11 293 Cell Lysate | +Inquiry |
RGS8-2368HCL | Recombinant Human RGS8 293 Cell Lysate | +Inquiry |
CELF3-7588HCL | Recombinant Human CELF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls1 Products
Required fields are marked with *
My Review for All cls1 Products
Required fields are marked with *
0
Inquiry Basket