Recombinant Full Length Arabidopsis Thaliana Upf0496 Protein At3G28270(At3G28270) Protein, His-Tagged
Cat.No. : | RFL23264AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UPF0496 protein At3g28270(At3g28270) Protein (Q9LHD9) (1-374aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-374) |
Form : | Lyophilized powder |
AA Sequence : | MALSKDLMLKCSEDMMSAYKSACEEHPKLKSFDASLQQRTNKMIDSLTVEDKNGSSSPHD AHMELSKHLVEVTQGVADFITEIEDDVWDNQALKYLVLAYFENTKKTLEIFKTIENCVEN AEMGQLLIREALAEFEKESAEKDVGGKKKKYEKTLEDLKSFKEMGDPFDGKVLTTQFERI KKQQESLLEEVSETRKKIQDEISNLEKKTLITNVVFGAAFAIVAVASIALIATGVGAAAG FGALAAPLLAAGWAGVYTTLDKKKDALNKQLEGLKKVEEIEESVEKGIKTNEEATETVSI LVDGLEDRIKNMLKLVDNAIDHEDNEAATRIVLTQISKKVEKLTKKITEVGESVEDHSKL IAKARLQVLQKINR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At3g28270 |
Synonyms | At3g28270; MZF16.5; UPF0496 protein At3g28270 |
UniProt ID | Q9LHD9 |
◆ Native Proteins | ||
APOC3-27333TH | Native Human APOC3 | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
◆ Cell & Tissue Lysates | ||
REV1-2414HCL | Recombinant Human REV1 293 Cell Lysate | +Inquiry |
CD320-001MCL | Recombinant Mouse CD320 cell lysate | +Inquiry |
CADM4-1838MCL | Recombinant Mouse CADM4 cell lysate | +Inquiry |
FAM118B-6445HCL | Recombinant Human FAM118B 293 Cell Lysate | +Inquiry |
C2C12-01HL | Human C2C12 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At3g28270 Products
Required fields are marked with *
My Review for All At3g28270 Products
Required fields are marked with *
0
Inquiry Basket