Recombinant Full Length Rat Proto-Oncogene Mas(Mas1) Protein, His-Tagged
Cat.No. : | RFL3403RF |
Product Overview : | Recombinant Full Length Rat Proto-oncogene Mas(Mas1) Protein (P12526) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | MDQSNMTSFAEEKAMNTSSRNASLGTSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHYYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSQ SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSTFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mas1 |
Synonyms | Mas1; Mas; Mas-1; Proto-oncogene Mas |
UniProt ID | P12526 |
◆ Recombinant Proteins | ||
AOAH-0398H | Recombinant Human AOAH Protein (Ser24-Gln300), His-tagged | +Inquiry |
KDM2A-0527H | Recombinant Human KDM2A Protein (R567-S681), Tag Free | +Inquiry |
LGMN-2160M | Recombinant Mouse LGMN Protein (18-325 aa), His-tagged | +Inquiry |
CCDC114-1293M | Recombinant Mouse CCDC114 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERI1-1590C | Recombinant Chicken ERI1 | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
REST-2417HCL | Recombinant Human REST 293 Cell Lysate | +Inquiry |
HSPA2-5355HCL | Recombinant Human HSPA2 293 Cell Lysate | +Inquiry |
KLK13-2900HCL | Recombinant Human KLK13 cell lysate | +Inquiry |
C16orf70-8247HCL | Recombinant Human C16orf70 293 Cell Lysate | +Inquiry |
C8orf74-7947HCL | Recombinant Human C8orf74 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mas1 Products
Required fields are marked with *
My Review for All Mas1 Products
Required fields are marked with *
0
Inquiry Basket