Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl46(Atl46) Protein, His-Tagged
Cat.No. : | RFL35714AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL46(ATL46) Protein (Q9FL07) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MSWVRFTIEQKDGNFAYPPPFYKDPILSPPSPPPPSSGNRISPAVLFVIVILAVLFFISG LLHLLVRFLIKHPSATASSRSNRFPEISTSDALQRQLQQLFHLNDSGLDQAFIDALPVFH YKEIVGSAGGGGGNGAAQEPFDCAVCLCEFSEKDKLRLLPMCSHAFHLNCIDTWLQSNST CPLCRGTLFSPGFSMENPMFDFDDIREDEEGVTENGSQKTMEIQEIVVEKGVLPVRLGKF KRLDNVGNGQGQDVVAGGETSSSNLDARRCFSMGSYQYILGNSELKVPFANDRLPRLKPQ DKESEQTGNSSSEDNKKINTVAKGESFSVSKIWLWPKKDKFSSDAQRRLPSSSLNVDDLP KLPWMEEHKKLENDGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL46 |
Synonyms | ATL46; At5g40250; MSN9.150; MSN9.16; RING-H2 finger protein ATL46; RING-type E3 ubiquitin transferase ATL46 |
UniProt ID | Q9FL07 |
◆ Native Proteins | ||
EGF-26462TH | Native Human EGF | +Inquiry |
AMY2A-8353H | Native Human AMY2A | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FMO3-660HCL | Recombinant Human FMO3 cell lysate | +Inquiry |
IL31RA-854HCL | Recombinant Human IL31RA cell lysate | +Inquiry |
C6orf120-7999HCL | Recombinant Human C6orf120 293 Cell Lysate | +Inquiry |
CNGA3-7410HCL | Recombinant Human CNGA3 293 Cell Lysate | +Inquiry |
UBXN2A-539HCL | Recombinant Human UBXN2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL46 Products
Required fields are marked with *
My Review for All ATL46 Products
Required fields are marked with *
0
Inquiry Basket