Recombinant Full Length Arabidopsis Thaliana Reticulon-Like Protein B17(Rtnlb17) Protein, His-Tagged
Cat.No. : | RFL16952AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Reticulon-like protein B17(RTNLB17) Protein (Q6DR04) (1-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-431) |
Form : | Lyophilized powder |
AA Sequence : | MESTPPYHRSNTKSASRLQDSSNPPNLSLDLVLSSPNTPNPSSPVPLRDILLLPPSPLRK SRTRLSDRLEMTSEDAMAVVRKRGKGKGGQKSLLASPRNPRRSRRRSEAVEEKEANLVIE EIVKLPPRKRKTNGRPKKDKQSSAPPLCSSSDLPNTCQSDLNLIGEIISDLVMWRDVAKS TLWFGFGCLSFLSSCFAKGVNFSVFSAVSNLGLVLLCGSFLSNTLCQRKNEDTKRAFHVS EDDVLRSARRVLPATNFFISKTSELFSGEPSMTLKVTPFLLLGAEYGHLITLWRLSAFGF FLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIF AVFIILVIFRYRRQNLQLTPEEVEPVENEQEEETLPQEEETVPQEEETVPQEEEQTQPSE ERALVVVVAET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTNLB17 |
Synonyms | RTNLB17; At2g20590; F23N11.9; Reticulon-like protein B17; AtRTNLB17 |
UniProt ID | Q6DR04 |
◆ Native Proteins | ||
IgG-343M | Native MONKEY IgG | +Inquiry |
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCD-1888HCL | Recombinant Human SGCD 293 Cell Lysate | +Inquiry |
C7orf31-7968HCL | Recombinant Human C7orf31 293 Cell Lysate | +Inquiry |
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ANAPC13-8867HCL | Recombinant Human ANAPC13 293 Cell Lysate | +Inquiry |
PACRG-3475HCL | Recombinant Human PACRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTNLB17 Products
Required fields are marked with *
My Review for All RTNLB17 Products
Required fields are marked with *
0
Inquiry Basket