Active Recombinant Human CTLA4, Fc-tagged, Biotinylated
Cat.No. : | CTLA4-593H |
Product Overview : | The recombinant human CTLA4 ECD is expressed as a 138-amino acid protein consisting of Lys36 - Asp161 region of CTLA4 (UniProt accession #Q16410) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. It contains 2 potential N-linked glycosylation sites. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 36-161 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to human B7 family ligands, CD80/B7-1 and CD86/B7-2, and anti-CTLA4 monoclonal antibody. Inhibit IL-2 secretion in stimulated human Jurkat T cell cells. |
Molecular Mass : | Calculated molecular mass 39.1 kDa; estimated by SDS-PAGE under reducing condition ~50 kDa probably due to glycosylation |
AA Sequence : | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSG NQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ] |
Official Symbol | CTLA4 |
Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3; |
Gene ID | 1493 |
mRNA Refseq | NM_001037631 |
Protein Refseq | NP_001032720 |
UniProt ID | P16410 |
Chromosome Location | 2q33 |
Pathway | Adaptive Immune System, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
CTLA4-137H | Recombinant Humancytotoxic T-lymphocyte-Associated Protein 4 | +Inquiry |
CTLA4-8852CF | Active Recombinant Monkey CTLA4 Protein, Fc-tagged, FITC conjugated | +Inquiry |
CTLA4-109CF | Active Recombinant Cynomolgus CTLA4 Protein, His-tagged, FITC conjugated | +Inquiry |
CTLA4-654M | Recombinant Mouse CTLA4 Protein, Fc-tagged | +Inquiry |
CTLA4-2233HAF488 | Recombinant Human CTLA4 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *
0
Inquiry Basket