Recombinant Full Length Arabidopsis Thaliana Outer Envelope Protein 64, Mitochondrial(Om64) Protein, His-Tagged
Cat.No. : | RFL3914AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Outer envelope protein 64, mitochondrial(OM64) Protein (F4KCL7) (1-603aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-603) |
Form : | Lyophilized powder |
AA Sequence : | MSNTLSLIQSNASNPKVWVVIGVTVAGIVILAETRKRRIRALREEDFGAFLDRFELLPFP PPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQWKKTHEAAEKTAVVVTTLLKNGATC VGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGCSSGSAVSVGAELVDFSLGIDTTGG VRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVGWFASDPSVLCQVGHALLNLSAVTH RRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSGYKTPKHVNVGQYVASNVPSLAEFC EQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWWQTCKSFLGPRFSNDVVTALKSKNE SIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPPRLNTKRNKSLNEFLDRTYALSCIA SMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLDTTLDVYASLQDQAKLASNLAPVSD TNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCFQQ AEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLR KHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OM64 |
Synonyms | OM64; TOC64-V; At5g09420; T5E8.220; Outer envelope protein 64, mitochondrial; Mitochondrial outer membrane protein 64; mtOM64; Translocon at the outer membrane of chloroplasts 64-V; AtTOC64-V |
UniProt ID | F4KCL7 |
◆ Recombinant Proteins | ||
SAP046A-022-4075S | Recombinant Staphylococcus aureus (strain: VET A6-001648, other: mec type IVh) SAP046A_022 protein, His-tagged | +Inquiry |
SULT1A1-30621TH | Recombinant Human SULT1A1, His-tagged | +Inquiry |
RSPO3-0654H | Active Recombinant Human RSPO3 protein, Fc-tagged | +Inquiry |
SQOR-13HFL | Recombinant Full Length Human SQOR Protein, C-Flag-tagged | +Inquiry |
RFL519MF | Recombinant Full Length Mouse Transmembrane Protein 54(Tmem54) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ALB-128C | Native Canine Serum Albumin | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
DNASE1-8333B | Native Bovine DNASE1 | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Esophagus-140H | Human Fetal Esophagus Lysate | +Inquiry |
MRGPRX2-4204HCL | Recombinant Human MRGPRX2 293 Cell Lysate | +Inquiry |
E4F1-522HCL | Recombinant Human E4F1 cell lysate | +Inquiry |
KLF6-4926HCL | Recombinant Human KLF6 293 Cell Lysate | +Inquiry |
Thyroid-501C | Chicken Thyroid Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OM64 Products
Required fields are marked with *
My Review for All OM64 Products
Required fields are marked with *
0
Inquiry Basket