Recombinant Full Length Arabidopsis Thaliana E3 Ubiquitin Protein Ligase Rin2(Rin2) Protein, His-Tagged
Cat.No. : | RFL19022AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana E3 ubiquitin protein ligase RIN2(RIN2) Protein (Q8VYC8) (1-578aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-578) |
Form : | Lyophilized powder |
AA Sequence : | MGIKYLPVSVASTALSFVGLQVWTELSLDRLRADGLIAKNISLGDSEHALELLLGSYFTI ALLTNFVLNVYILLVLSLKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQG VLWTVWLTVLCTLKMFQALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLSL MTYNTIGSAVYLLLLFEPCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDSM TAGSLLEWKGLLNRNLGFFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSA ILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLGC LRSWLDQGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALAT GLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLAS VGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNIL AMAETVREVMPHVPDEIIFQDLQRTNSVAVTVNNLLQM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIN2 |
Synonyms | RIN2; AMFR-1A; At4g25230; F24A6.70; E3 ubiquitin protein ligase RIN2; AMF receptor-like protein 1A; RING-type E3 ubiquitin transferase RIN2; RPM1-interacting protein 2 |
UniProt ID | Q8VYC8 |
◆ Recombinant Proteins | ||
RIN2-1347H | Recombinant Human RIN2 Protein, MYC/DDK-tagged | +Inquiry |
Rin2-5517M | Recombinant Mouse Rin2 Protein, Myc/DDK-tagged | +Inquiry |
RFL19022AF | Recombinant Full Length Arabidopsis Thaliana E3 Ubiquitin Protein Ligase Rin2(Rin2) Protein, His-Tagged | +Inquiry |
RIN2-1040H | Recombinant Human RIN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RIN2-722H | Recombinant Human RIN2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIN2 Products
Required fields are marked with *
My Review for All RIN2 Products
Required fields are marked with *
0
Inquiry Basket