Recombinant Full Length Arabidopsis Thaliana Chaperone Protein Dnaj 13(Atj13) Protein, His-Tagged
Cat.No. : | RFL32374AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Chaperone protein dnaJ 13(ATJ13) Protein (Q39079) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MMGQEAAPTGPPNRELYALLNLSPEASDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENF QRICEAYEILSDETKRLIYDLYGMEGLNSGLELGPRLSKADEIKEELERIKRRNEEAKKM AHFQPTGSILFNLSVPHFLVGDGIMRGMVMASQVQSQLSKDDAIAIGGNLAANEKSGGGV ATAILRRQISPVSSIEFVASTGLQSLIGVQTTRQLTIHSTATINISKSLSDGSINLTNTW TRQLSETSSGNIELALGMRSAITVGWKKRDENVSAAGDFKIESGGLGASARYTRKLSSKS HGRIVGRIGSNALEIELGGGRQISEFSTVRMMYTVGLKGIFWKVELHRGSQKLIVPILLS AHLAPVFATGAFIVPTSLYFLLKKFVVKPYLLKREKQKALENMEKTWGQVGEARARAEKA QQLLQTVATRKKNRQVETDGLIVTKALYGDPKAIERRNEGVEGLDSGVIDVTVPMNFLVS DSGQLKLHEGVKKSGIMGFCDPCPGQPKQLYIAYTYHSQPFEVIVGDYEELSIPQEGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATJ13 |
Synonyms | ATJ13; B13; D3; At2g35720; T20F21.9; Chaperone protein dnaJ 13; AtDjB13; AtJ13 |
UniProt ID | Q39079 |
◆ Recombinant Proteins | ||
TOMM22-6217R | Recombinant Rat TOMM22 Protein | +Inquiry |
IL1R2-112H | Recombinant Human interleukin 1 receptor, type II Protein, His tagged | +Inquiry |
RFL34016BF | Recombinant Full Length Bovine Lysoplasmalogenase(Tmem86B) Protein, His-Tagged | +Inquiry |
BNIP3L-378R | Recombinant Rhesus Macaque BNIP3L Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS17-4196C | Recombinant Chicken MRPS17 | +Inquiry |
◆ Native Proteins | ||
Collagen-44H | Native Human Collagen I | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
ALB-128C | Native Canine Serum Albumin | +Inquiry |
IgG-123G | Native Guinea pig Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL3-224HCL | Recombinant Human DERL3 lysate | +Inquiry |
Ovary-40H | Human Ovary Tumor Tissue Lysate | +Inquiry |
ULBP2-1791HCL | Recombinant Human ULBP2 cell lysate | +Inquiry |
GPA33-1975HCL | Recombinant Human GPA33 cell lysate | +Inquiry |
Orange-391P | Plant Plant: Orange Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATJ13 Products
Required fields are marked with *
My Review for All ATJ13 Products
Required fields are marked with *
0
Inquiry Basket