Recombinant Full Length Arabidopsis Thaliana Cbs Domain-Containing Protein Cbscbspb1(Cbscbspb1) Protein, His-Tagged
Cat.No. : | RFL1460AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CBS domain-containing protein CBSCBSPB1(CBSCBSPB1) Protein (Q9FMV3) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MASQGGPRRSLSVTTASLHGKKKSMDMAERGLDTGRRSLTVSRSPLGLTGGERTVKRLRL SKALTVPATTTIYEACKRMASRRVDALLLTDSNEMLCGILTDKDIATRVISQELNVEETP VSKVMTKNPMFVLSETLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMER AAEKGKAIAAAVEGVEKSWGTNTSVPNTFIETLRDRMFRPSLSTIIPDDTKVLKVSPTDT VLTVAKKMVEFQSSCAVVIIEDKLRGIFTSKDILMRVVAENLPPSETLVETVMTQNPEST IVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGNEATNT MMQKFWDSAMALSPNEDDEDSRSESSMKVASEAETGKSFPFANTFSFKIEDKKHRKHRFI SDTRSLTEVITAIIQRVGDDIDPDNFPQILYEDEDHDKVLLASDSDLQAAIEHAKSIGWK SLRLHLDDSREGKGRRRRRASGSAESMEYVETDAWAAAYSGVAAGAALVAGLGFMAFLRK FGH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSCBSPB1 |
Synonyms | CBSCBSPB1; At5g63490; MLE2.12; CBS domain-containing protein CBSCBSPB1 |
UniProt ID | Q9FMV3 |
◆ Recombinant Proteins | ||
METTL14-4410H | Recombinant Human METTL14 Protein, GST-tagged | +Inquiry |
NOTCH2NL-6718HF | Recombinant Full Length Human NOTCH2NL Protein, GST-tagged | +Inquiry |
ABCA13-1074M | Recombinant Mouse ABCA13 Protein | +Inquiry |
TNFRSF10B-0778M | Active Recombinant Mouse TNFRSF10B protein, His-tagged | +Inquiry |
PTHLH-4047H | Recombinant Human PTHLH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
CFI-105H | Active Native Human Factor I | +Inquiry |
FDP-E-50H | Native Human Fibrinogen Degrading Product-E | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLSTN2-7430HCL | Recombinant Human CLSTN2 293 Cell Lysate | +Inquiry |
STT3A-1382HCL | Recombinant Human STT3A 293 Cell Lysate | +Inquiry |
C14orf177-8279HCL | Recombinant Human C14orf177 293 Cell Lysate | +Inquiry |
PVRL2-3010HCL | Recombinant Human PVRL2 cell lysate | +Inquiry |
ARHGEF4-8730HCL | Recombinant Human ARHGEF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBSCBSPB1 Products
Required fields are marked with *
My Review for All CBSCBSPB1 Products
Required fields are marked with *
0
Inquiry Basket