Recombinant Human METTL14 Protein, GST-tagged

• Cat.No.: METTL14-4410H
• Product Overview: Human METTL14 full-length ORF ( NP_066012.1, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. GO annotations related to this gene include RNA binding and mRNA (2-O-methyladenosine-N6-)-methyltransferase activity.
• Molecular Mass: 78.6 kDa
• AA Sequence: MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: METTL14 methyltransferase like 14 [ Homo sapiens (human) ]
• Official Symbol: METTL14
• Synonyms: METTL14; methyltransferase like 14; Hmettl14; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62
• Gene ID: 57721
• mRNA Refseq: NM_020961
• Protein Refseq: NP_066012
• MIM: 616504
• UniProt ID: Q9HCE5