Recombinant Full Length Human NOTCH2NL Protein, GST-tagged

• Cat.No.: NOTCH2NL-6718HF
• Product Overview: Human NOTCH2NL full-length ORF ( AAH19835, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: NOTCH2NL (Notch 2 N-Terminal Like) is a Protein Coding gene. Among its related pathways are Notch Signaling Pathway (sino). GO annotations related to this gene include calcium ion binding. An important paralog of this gene is NOTCH2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.7 kDa
• Protein length: 236 amino acids
• AA Sequence: MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOTCH2NL notch 2 N-terminal like [ Homo sapiens ]
• Official Symbol: NOTCH2NL
• Synonyms: NOTCH2NL; notch 2 N-terminal like; Notch homolog 2 (Drosophila) N terminal like; notch homolog 2 N-terminal-like protein; N2N; Notch homolog 2 N-terminal like protein; FLJ35032; FLJ55807
• Gene ID: 388677
• mRNA Refseq: NM_203458
• Protein Refseq: NP_982283
• MIM: 618025
• UniProt ID: Q7Z3S9