Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 26(Abcg26) Protein, His-Tagged
Cat.No. : | RFL27345AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 26(ABCG26) Protein (Q9LK50) (1-685aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-685) |
Form : | Lyophilized powder |
AA Sequence : | MEIRRSTEEVEENHVMQITGSNGIVHNMEFMPQAYLRNQYSSEIDIDEEFVSTYPLEDAP LPIFLKFEDVEYKVRNSHASSANLVKTMVSKVVTHTNPDPDGYKHILKGITGSTGPGEIL ALMGPSGSGKTTLLKIMGGRLTDNVKGKLTYNDIPYSPSVKRRIGFVTQDDVLLPQLTVE ETLAFAAFLRLPSSMSKEQKYAKIEMIIKELGLERCRRTRVGGGFVKGISGGERKRASIA YEILVDPSLLLLDEPTSGLDSTSATKLLHILQGVAKAGRTVITTIHQPSSRMFHMFDKLL LISEGHPAFYGKARESMEYFSSLRILPEIAMNPAEFLLDLATGQVSDISLPDELLAAKTA QPDSEEVLLKYLKQRYKTDLEPKEKEENHRNRKAPEHLQIAIQVKKDWTLSWWDQFLILS RRTFRERRRDYFDKLRLVQSLGVAVVLGLLWWKSKTDTEAHLRDQVGLMFYICIFWTSSS LFGAVYVFPFEKIYLVKERKAEMYRLSVYYVCSTLCDMVAHVLYPTFFMIIVYFMAEFNR NIPCFLFTVLTILLIAITSQGAGEFLGASVLSIKRAGMIASLVLMLFLLTGGYYVQHIPK FMQWLKYLSFMHYGFRLLLKVQYSADQLFECGSKGGCRTLQSSSSFDTINLNGGLQELWV LLAMAFGYRLCAYFCLRKKISICHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG26 |
Synonyms | ABCG26; WBC27; At3g13220; MJG19.19; ABC transporter G family member 26; ABC transporter ABCG.26; AtABCG26; Putative white-brown complex homolog protein 27; AtWBC27 |
UniProt ID | Q9LK50 |
◆ Recombinant Proteins | ||
Gpha2-3287M | Recombinant Mouse Gpha2 Protein, Myc/DDK-tagged | +Inquiry |
CCS-3038HF | Recombinant Full Length Human CCS Protein, GST-tagged | +Inquiry |
NEUROD1-1505H | Recombinant Human NEUROD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QL3-739H | Recombinant Human C1QL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL29682PF | Recombinant Full Length Picea Abies Apocytochrome F(Peta) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
NP-001HCL | Recombinant H1N1 NP cell lysate | +Inquiry |
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
MCOLN3-4413HCL | Recombinant Human MCOLN3 293 Cell Lysate | +Inquiry |
CDYL2-7600HCL | Recombinant Human CDYL2 293 Cell Lysate | +Inquiry |
OASL-3612HCL | Recombinant Human OASL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ABCG26 Products
Required fields are marked with *
My Review for All ABCG26 Products
Required fields are marked with *
0
Inquiry Basket