Recombinant Human C1QL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C1QL3-739H
• Product Overview: C1QL3 MS Standard C13 and N15-labeled recombinant protein (NP_001010908) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production.
• Molecular Mass: 26.5 kDa
• AA Sequence: MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYADTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C1QL3 complement C1q like 3 [ Homo sapiens (human) ]
• Official Symbol: C1QL3
• Synonyms: C1QL3; complement component 1, q subcomponent-like 3; complement C1q-like protein 3; C1ql; C1QTNF13; CTRP13; K100
• Gene ID: 389941
• mRNA Refseq: NM_001010908
• Protein Refseq: NP_001010908
• MIM: 615227
• UniProt ID: Q5VWW1